PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0267s0240.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 585aa    MW: 65220.6 Da    PI: 4.8366
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0267s0240.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS439.22.9e-1342155842374
                    GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                             ++lL+e A+a+s+g+ e+a++l+++l++l+s +gdp qR+aay++e+Laar+a+s++ lykal+++e +   ss++laa+++++e++
  SapurV1A.0267s0240.3.p 215 RQLLFESANAISEGNIEKASTLINELRQLVSIQGDPSQRIAAYMVEGLAARMAGSGKYLYKALKCKEPP---SSDRLAAMQILFEIC 298
                             689*****************************************************************9...9************** PP

                    GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelg 173
                             P++kf++++aN a+ ea++ge+rvHiiDfdi+qG Q+++L+q+La+ +++ p+lR+Tgv++p+s+  +   l+ +g+rL+k+Ae+l+
  SapurV1A.0267s0240.3.p 299 PCFKFGFMAANGAMIEAFKGERRVHIIDFDINQGSQYITLIQTLANVQGKLPHLRLTGVDDPDSVqrHVGGLRIIGQRLEKLAEALK 385
                             ***************************************************************99888999**************** PP

                    GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                             v+fef++ va++++ +++++L+ kpgEal+Vn+++qlh+++desvs+ +erd++L++ ksl+Pk+v+vveq++++n+++F+ rf+ea
  SapurV1A.0267s0240.3.p 386 VSFEFHA-VASKTSLVNPSMLNRKPGEALIVNFAFQLHHMPDESVSTVNERDQLLRMAKSLNPKLVTVVEQDVNTNTAPFFPRFTEA 471
                             *******.7****************************************************************************** PP

                    GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksd 347
                              +yysa+fdsl+++lpres++r +vE+++l+r+ivn+vaceg+er+er e ++kWr+r+++aGF + +++ ++++ ++ l++++ ++
  SapurV1A.0267s0240.3.p 472 YNYYSAVFDSLDVTLPRESQDRLNVEKQCLARDIVNIVACEGEERIERYEVAGKWRARMMMAGFISCSITPNVVDMIRILIKEYCDR 558
                             *************************************************************************************66 PP

                    GRAS 348 gyrveeesgslvlgWkdrpLvsvSaWr 374
                              y++++e g+l +gW+d++L+++SaW+
  SapurV1A.0267s0240.3.p 559 -YMLKQEAGALHFGWEDKSLIVASAWK 584
                             .*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.167188565IPR005202Transcription factor GRAS
PfamPF035149.9E-132215584IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MSLVGPAELS ATPYGNHKLY SLKGSKDNSG LSAQIFSPDK RQNMYMTDSY SSESYEKYFL  60
DSPTEELIQP SSSGISGNSA PPQGTSSYQP RKNSGSSMSP QDPYDTCFTL TTPCDGYQFN  120
SESDYMNIES PDPLDYDEYK MKLKLQELER ALLNDNDEDG MFGNSQSLEM DGEWSDPIQN  180
GMLHDSPKES SSSDSSLSSI SNNKEVSQLS PQTPRQLLFE SANAISEGNI EKASTLINEL  240
RQLVSIQGDP SQRIAAYMVE GLAARMAGSG KYLYKALKCK EPPSSDRLAA MQILFEICPC  300
FKFGFMAANG AMIEAFKGER RVHIIDFDIN QGSQYITLIQ TLANVQGKLP HLRLTGVDDP  360
DSVQRHVGGL RIIGQRLEKL AEALKVSFEF HAVASKTSLV NPSMLNRKPG EALIVNFAFQ  420
LHHMPDESVS TVNERDQLLR MAKSLNPKLV TVVEQDVNTN TAPFFPRFTE AYNYYSAVFD  480
SLDVTLPRES QDRLNVEKQC LARDIVNIVA CEGEERIERY EVAGKWRARM MMAGFISCSI  540
TPNVVDMIRI LIKEYCDRYM LKQEAGALHF GWEDKSLIVA SAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-5123358422375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2164550.0AC216455.1 Populus trichocarpa clone POP032-C02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302201.10.0SCARECROW-LIKE 1 family protein
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLB9GTP10.0B9GTP1_POPTR; SCARECROW-LIKE 1 family protein
STRINGPOPTR_0002s07430.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1